ZNF93 anticorps

N° du produit ABIN1449891

Cet anticorps anti-ZNF93 est un anticorps Lapin Polyclonal détectant ZNF93 dans WB. Adapté pour Humain, Boeuf (Vache), Souris, Rat, Poisson zèbre (Danio rerio) et Xenopus laevis.

Aperçu rapide pour ZNF93 anticorps (ABIN1449891)

Antigène: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Reactivité: Humain, Boeuf (Vache), Souris, Rat, Poisson zèbre (Danio rerio), Xenopus laevis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF93 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ZNF93 anticorps

Réactivité croisée (Details): Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine

Purification: Purified using peptide immunoaffinity column

Immunogène: A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Détails sur ZNF93

Antigène: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Autre désignation: ZNF93

Sujet: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34

Poids moléculaire: 71 kDa (620 aa)

ID gène: 81931

NCBI Accession: NP_112495